Protein or peptide name:	SPAR
Chromosome:	4
Protein or peptide start site:	43730965
Protein or peptide end site:	43731189
ncRNA start site:	43730034
ncRNA end site:	43734534
Genome Browser:
Protein or peptide sequence:	METAVIGMVAVLFVITMAITCILCYFSYDSHTQDPERSSRRSFTVATFHQEASLFTGPALQSRPLPRPQNFWTVV
Protein or peptide length:	75aa
ncRNA type:	lncRNA
ncRNA name:	SPAR
Entrez ID:	71406
Experimental species:	Mus musculus
Experimental techniques:	Immunofluorescence staining/Western blotting
Experimental sample (cell line and/or tissue):	Mouse myoblast C2C12 cells
Description:	Here we identify and functionally characterize a novel polypeptide encoded by the lncRNA LINC00961.
Subcellular location:	late endosome/lysosome
Function:	Activation of mTORC1 and promotes muscle regeneration.
Title of paper:	mTORC1 and muscle regeneration are regulated by the LINC00961-encoded SPAR polypeptide
PMID:	28024296
Year of publication:	2017